SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F9X3S6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F9X3S6
Domain Number 1 Region: 518-671
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.15e-28
Family Regulator of G-protein signaling, RGS 0.0013
Further Details:      
 
Domain Number 2 Region: 380-492
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.12e-24
Family DEP domain 0.0082
Further Details:      
 
Domain Number 3 Region: 203-330
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000068
Family PadR-like 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0F9X3S6
Sequence length 690
Comment (tr|A0A0F9X3S6|A0A0F9X3S6_TRIHA) Uncharacterized protein {ECO:0000313|EMBL:KKO99294.1} KW=Complete proteome; Reference proteome OX=5544 OS=Trichoderma harzianum (Hypocrea lixii). GN=THAR02_08610 OC=Trichoderma.
Sequence
MAAFLSQPLNTIVEPLPPSSRQQPDRTQSLTSASRSPAPAAAPAPAERRFEATKSPPPVS
QSRRHASSVSIGSSSLPRHQRTSSSILSRAAAALDRTQSAIASISEPVIRNRQSNSTLAR
LSLTAPSHQLRDEPASPDRPTAFNYPSSQSLLSNPGDGKQSSFSSAQHSPTLPSTGLSSE
SSSPNKMHQTSSRLLRMTDDDRPFTRDFKDLFSTLIVSLLPLGSHRVRLTKVDYTFLSED
AINNLGSLKFSQSNRMPDPKDPSRIVTTTTTTTFSMAKDMARSICQRFVEARFIESADGK
MQPVYNMKGSVWQLTAKGVAILDRFCSRNGIQQKQVAELVSLHCCSLVILEREQHSDKIL
SDRGTVEVIFRRFVGAETRNVKPNVAAADSDSLHDYEDGLTGVKMANERRVNGKVHKDTF
TGKATSDWLVDCCTIVDKREAIEIASLFVEFELIDTVVQDRSFMLQNPGCHLFQPTKYAV
YQISQRGKDVINGTSSRGRPSESEAGTGSQRNGVVRDSNTQRLEKILNDPALRLLFRENL
RETHCEENLSFYKDVNDFVQNCKTAIRQAEANPSNNSMDIIKEIMAQAYGIYNAFLAPGS
PCELNIDHQLRNNLATRMTKAVGQENGMIETLQEVTSLFENAQNAVFKLMASDSVPKFLR
NAKYEQQLQNFNLDGSSRGVERSLSRSNRK
Download sequence
Identical sequences A0A0F9X3S6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]