SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F9XIX3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F9XIX3
Domain Number 1 Region: 14-65,164-245
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 5.76e-24
Family Regulator of G-protein signaling, RGS 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0F9XIX3
Sequence length 360
Comment (tr|A0A0F9XIX3|A0A0F9XIX3_TRIHA) Uncharacterized protein {ECO:0000313|EMBL:KKP04846.1} KW=Complete proteome; Reference proteome OX=5544 OS=Trichoderma harzianum (Hypocrea lixii). GN=THAR02_03024 OC=Trichoderma.
Sequence
MEDPRDTTASTTPQPDMTRNRLPTLFEVLSRRTLPPVDLFSFYIYMRDQQRSVDYLDFWL
DVAQHMSLCRHYVRELRRSVLIATPDLEKSSKRSSQIMDLGEMDNRAAGPSMYATEKERD
QDAQMSAFLREDQSHESPQTHSGSNRTKPSPPFSHATDSNSPAHTVARQDIRASAEKILY
TFLMPGAEREITLPGSITQDVTASIEEYGRDDPEVFDVAKDYVFQAMERDAFPGFLRMKA
LGNLIPPTLVMRLIIGLVAMFGAFWTSFILIFLDKSRATRCWLILPFTIGVYFLASYQYS
LDPILALIGFSEYTPFNFSRIREPYVRRLLAKRALMVLAVTTLIDAGLCVLFILVPGKRL
Download sequence
Identical sequences A0A0F9XIX3 A0A1T3CA36
jgi|Triha1|480960|fgenesh1_pg.5_#_131

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]