SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F9XUH5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F9XUH5
Domain Number 1 Region: 6-124
Classification Level Classification E-value
Superfamily Nucleotidyltransferase substrate binding subunit/domain 2.2e-21
Family HEPN domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0F9XUH5
Sequence length 139
Comment (tr|A0A0F9XUH5|A0A0F9XUH5_9BACT) HEPN domain protein {ECO:0000313|EMBL:KKP22949.1} KW=Complete proteome; Reference proteome OX=1619077 OS=candidate division TM6 bacterium GW2011_GWF2_28_16. GN=SZ59_C0004G0024 OC=Bacteria; Candidatus Dependentiae.
Sequence
MQMHDAWLKKAHSDLLIAKKLFDLNELDLFDGAAYHTQQCAEKAFKSYLAYKKQNIEKTH
NLVLLVKLCSQYDAEFESLLNISAILNPYSIKFRYPDDVMVPEKSDLKEAIDSAEVIFKF
IKKKISEFNTGQGSIFRKL
Download sequence
Identical sequences A0A0F9XUH5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]