SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G0AEZ4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G0AEZ4
Domain Number 1 Region: 40-81
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000429
Family VWC domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0G0AEZ4
Sequence length 88
Comment (tr|A0A0G0AEZ4|A0A0G0AEZ4_9BACT) Kielin/chordin-like protein {ECO:0000313|EMBL:KKP55349.1} KW=Complete proteome OX=1619088 OS=candidate division WS6 bacterium GW2011_GWB1_33_6. GN=UR47_C0002G0066 OC=Bacteria; Candidatus Dojkabacteria.
Sequence
MDEKKNNFLYGLSITLGTIVLGLISYIFYISNIASIKEPPRCEYNGWAYADKETYESQDG
CNTCFCHTGETVCTQIACESTSIDLIDE
Download sequence
Identical sequences A0A0G0AEZ4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]