SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G0ELN6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G0ELN6
Domain Number 1 Region: 5-169
Classification Level Classification E-value
Superfamily N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) 8.89e-62
Family N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) 0.00000158
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0G0ELN6
Sequence length 171
Comment (tr|A0A0G0ELN6|A0A0G0ELN6_9BACT) 5-(carboxyamino)imidazole ribonucleotide mutase {ECO:0000256|HAMAP-Rule:MF_01929} KW=Complete proteome; Reference proteome OX=1618809 OS=Parcubacteria group bacterium GW2011_GWA2_36_24. GN=US12_C0038G0004 OC=Bacteria; unclassified Parcubacteria group.
Sequence
MKNLKVGIVMGSDSDLEVMAEAAKILEEFGVPYEITVASAHRSPEIVHKYADNARKCGIK
VVIAGAGGAAHLAGVMASLLTLPIIGIPIKTKSLDGLDSLLSTVNMPPGVPVATVGINAG
KNAGLLAIQILSLSDKNLEKKLISYKKKMSSEIKIKGEKLSKIGYKKYLEK
Download sequence
Identical sequences A0A0G0ELN6 A0A0G0EXX1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]