SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G0FGN4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G0FGN4
Domain Number 1 Region: 2-101,131-191
Classification Level Classification E-value
Superfamily LigT-like 0.00000000204
Family tRNA splicing product Appr>p cyclic nucleotide phosphodiesterase 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0G0FGN4
Sequence length 192
Comment (tr|A0A0G0FGN4|A0A0G0FGN4_9BACT) Uncharacterized protein {ECO:0000313|EMBL:KKQ12735.1} KW=Complete proteome; Reference proteome OX=1618718 OS=Candidatus Moranbacteria bacterium GW2011_GWF1_36_78. GN=US27_C0018G0001 OC=Bacteria; Candidatus Moranbacteria.
Sequence
MPPADVAKYVAKLSKEISEKEKAYFILDNKNFYPHITIYTSEYPNCNIKKILDKVEKISK
KLSGVKFKFKKIDDDYGYVGVVMHRSKEIRKIHEIIISELNPLREGHIREKFHNSDLSKE
EKENIQKYGYPNLINLYSPHITITRLKNEKNAREISKEIKWFKKEFILGKIGVYGMGENG
TCTELIKEFKLR
Download sequence
Identical sequences A0A0G0FGN4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]