SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G0G9H7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G0G9H7
Domain Number 1 Region: 83-219
Classification Level Classification E-value
Superfamily Sortase 4.19e-28
Family Sortase 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0G0G9H7
Sequence length 241
Comment (tr|A0A0G0G9H7|A0A0G0G9H7_9BACT) Sortase family protein {ECO:0000313|EMBL:KKP88372.1} KW=Complete proteome; Reference proteome OX=1618333 OS=Berkelbacteria bacterium GW2011_GWA2_35_9. GN=UR93_C0015G0002 OC=Bacteria; Candidatus Berkelbacteria.
Sequence
MKKIVLVGLTFILFASLFYLLITLPTWIVRLKYKIRGTEPINNSLVFPSTNAKNDISNIS
TNITDESGATKKVYRFPKDLVDNQLFIPKINLTAPINWGVATDDASLLNSLKTGLAHFNI
SSLPGEIGNIFVSGHSSYYWWDKGQYKKVFALLPEVKNGDAIYLKYQNKPYIYQVEETKV
VKPTDISVVNKTDYPVISLMTCVPIGTAQNRLIVRAKQIYPQKSQVSQQRENNLQTIPKV
W
Download sequence
Identical sequences A0A0G0G9H7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]