SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G0GT89 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G0GT89
Domain Number 1 Region: 11-130
Classification Level Classification E-value
Superfamily Nucleotidyltransferase substrate binding subunit/domain 1.96e-19
Family HEPN domain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0G0GT89
Sequence length 132
Comment (tr|A0A0G0GT89|A0A0G0GT89_9BACT) Uncharacterized protein {ECO:0000313|EMBL:KKQ02974.1} KW=Complete proteome; Reference proteome OX=1618809 OS=Parcubacteria group bacterium GW2011_GWA2_36_24. GN=US12_C0022G0002 OC=Bacteria; unclassified Parcubacteria group.
Sequence
MSFNVNKIVSYWENHAEYDIKTAKHMFDTKRYPYVLFMCHLSIEKLLKGIYVKENGKHSI
YTHNLVELAKKIKIDFSDEQKKLLAELSGFNIEARYPEWKSNFYKIATKSFTEKYYTQTK
KFYLWLKKYLKK
Download sequence
Identical sequences A0A0G0GT89 A0A0G0H331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]