SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G0HWE1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G0HWE1
Domain Number 1 Region: 47-176
Classification Level Classification E-value
Superfamily Sortase 3.27e-19
Family Sortase 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0G0HWE1
Sequence length 179
Comment (tr|A0A0G0HWE1|A0A0G0HWE1_9BACT) Uncharacterized protein {ECO:0000313|EMBL:KKQ16374.1} KW=Complete proteome OX=1618417 OS=Candidatus Daviesbacteria bacterium GW2011_GWA1_36_8. GN=US28_C0002G0041 OC=Bacteria; Candidatus Daviesbacteria.
Sequence
MLKSLANPLKLLGIILISLSLISIFQRYSPTRLSFAFDPDSQNISSINSSQTPQRIQIEN
LNINLPIEPSSIKNSKLEISSRGVSYLTSTPLPGQTGNSILYGHNYTNILGNLTKIKPGD
IVRIYYTDGSFKDFEVSYTLEVSPKDSKVLENSTDTRITLYTCSGFLDTKRFVAVAISN
Download sequence
Identical sequences A0A0G0ETV4 A0A0G0HWE1 A0A1F5K3Z1 K2CZ34

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]