SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G0J2S8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G0J2S8
Domain Number 1 Region: 34-123
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000252
Family Fibronectin type III 0.0087
Further Details:      
 
Domain Number 2 Region: 145-198
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000000275
Family Type I dockerin domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0G0J2S8
Sequence length 202
Comment (tr|A0A0G0J2S8|A0A0G0J2S8_9BACT) Uncharacterized protein {ECO:0000313|EMBL:KKQ61237.1} KW=Complete proteome; Reference proteome OX=1618897 OS=Parcubacteria group bacterium GW2011_GWC1_38_22. GN=US82_C0024G0011 OC=Bacteria; unclassified Parcubacteria group.
Sequence
MEKIKIKIKIKILAIVFMSLYVSIAFACNVFAAASAKVSWVAPIYDEGAGTPALTGLTGY
RVYYDTVGDWVTDCTAWAADHNANPLTGNYVDVASGVTIAHFFANSLTAGATYNFSVVAY
DGDDNLSNCATEDGTGNTYVSKRVLYSGDINKDGVVNGGDVTTAAGVYLSNSCGISSDVN
NDCWVNGGDVTILAEDYLKPAL
Download sequence
Identical sequences A0A0G0J2S8 A0A0G0K583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]