SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G0L6A4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G0L6A4
Domain Number 1 Region: 4-125,159-210
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.84e-34
Family Nucleotide and nucleoside kinases 0.0000582
Further Details:      
 
Domain Number 2 Region: 128-160
Classification Level Classification E-value
Superfamily Microbial and mitochondrial ADK, insert "zinc finger" domain 0.000000852
Family Microbial and mitochondrial ADK, insert "zinc finger" domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0G0L6A4
Sequence length 214
Comment (tr|A0A0G0L6A4|A0A0G0L6A4_9BACT) Adenylate monophosphate kinase {ECO:0000256|HAMAP-Rule:MF_00235} KW=Complete proteome; Reference proteome OX=1618811 OS=Parcubacteria group bacterium GW2011_GWA2_38_13. GN=US74_C0009G0024 OC=Bacteria; unclassified Parcubacteria group.
Sequence
MIRNILIFGAQGSGKGTQAELLAQTCGSMNISIGNIFRQEVYKKTPLGIEAKKFTDEGKL
VPDDVVNEIVASRLKQKDIQEHGVVLEGYPRNIVQADALEKIISLTDVVVIDISDDEAVN
RISKRLTCVCGKTYNTDYNASHVAGICDECGALLFIRDDDKPDAIKHRLETYHKETEPLF
LMYEKKGILHRVNGEQKINEVYKAILKALNMETP
Download sequence
Identical sequences A0A0G0L6A4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]