SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G0LAC3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G0LAC3
Domain Number 1 Region: 112-154
Classification Level Classification E-value
Superfamily R3H domain 0.00000000314
Family R3H domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0G0LAC3
Sequence length 160
Comment (tr|A0A0G0LAC3|A0A0G0LAC3_9BACT) Uncharacterized protein {ECO:0000313|EMBL:KKQ87962.1} KW=Complete proteome; Reference proteome OX=1618414 OS=Candidatus Curtissbacteria bacterium GW2011_GWC2_38_9. GN=UT12_C0031G0007 OC=Bacteria; Candidatus Curtissbacteria.
Sequence
MNQEKIKNLIEELVRDTNFHVREFGSSYNADNDTYWFSVYSDDSHFFIGRGGEGLQALNH
LARRMVEKVFCAQENTSKIPNIVVDVNDYQKKRIESLHTLAHMMAERARYFKSNIEVEPM
SSYERRIIHEHLSNRPDIKTESTGDGRDRRVVIKYIGQNL
Download sequence
Identical sequences A0A0G0LAC3 A0A1F6WIX4 A0A1F6XPW9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]