SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G0LFB3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G0LFB3
Domain Number 1 Region: 2-78
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 5.23e-27
Family Ribosomal L27 protein 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0G0LFB3
Sequence length 81
Comment (tr|A0A0G0LFB3|A0A0G0LFB3_9BACT) 50S ribosomal protein L27 {ECO:0000313|EMBL:KKQ60089.1} KW=Complete proteome; Reference proteome OX=1618421 OS=Candidatus Daviesbacteria bacterium GW2011_GWA2_38_17. GN=US80_C0002G0007 OC=Bacteria; Candidatus Daviesbacteria.
Sequence
MAHKTGGGSTRKNKDSISKRLGVKRFGGEKVIPGNILVRQKGNKFYPGVGTKQGNDYTIF
AISTGKVAFKKSIDKRVVSVI
Download sequence
Identical sequences A0A0G0LFB3 A0A0G0MTI0 A0A1F5MTU5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]