SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G0Q1E6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G0Q1E6
Domain Number 1 Region: 21-184
Classification Level Classification E-value
Superfamily MgtE membrane domain-like 4.45e-27
Family MgtE membrane domain-like 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0G0Q1E6
Sequence length 187
Comment (tr|A0A0G0Q1E6|A0A0G0Q1E6_9BACT) MgtE integral membrane protein {ECO:0000313|EMBL:KKR04240.1} KW=Complete proteome; Reference proteome OX=1618995 OS=Candidatus Uhrbacteria bacterium GW2011_GWF2_39_13. GN=UT30_C0010G0004 OC=Bacteria; Candidatus Uhrbacteria.
Sequence
MFNHKKETIYADDDTETLSLLMRLRLPPLIIGLFFGIGISFLTSRFEEVLTKNIHTAFFI
PFVVYLADAIGTQTETIFSRDLKTGKASFHGYLIKEASIGLLTGILFGGVSFGIVLWWFS
DVRLALSVGISTFLAIFIAPLIALCTTQVLSDLNIDPATGSGPIATVIQDATSIIIYGMV
SSIFFLS
Download sequence
Identical sequences A0A0G0Q1E6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]