SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G0T712 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G0T712
Domain Number 1 Region: 45-183
Classification Level Classification E-value
Superfamily Sortase 4.32e-21
Family Sortase 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0G0T712
Sequence length 184
Comment (tr|A0A0G0T712|A0A0G0T712_9BACT) Peptidase C60 family protein {ECO:0000313|EMBL:KKR72789.1} KW=Complete proteome OX=1618482 OS=Candidatus Roizmanbacteria bacterium GW2011_GWB1_40_7. GN=UU14_C0002G0042 OC=Bacteria; Candidatus Roizmanbacteria.
Sequence
MSKRTNVIKLLGNALIALSFLGFIFIYYPIIRGYLFPPTISIPDNQPAIRIEKINAVAPL
IFNVDPWNKEEYLEALSNGVAHAKGTFLPGETGTIFLFAHSSDAPWRLTRYNTVFLRLGE
LEPGDEIHITTEKGEFIYRVREKKVVWPNETEYLTNIERDQLILQTCSPVGTDLKRLLVF
ADPV
Download sequence
Identical sequences A0A0G0T712 A0A0G0XGD5 A0A0G0Y2M4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]