SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G0U3H4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G0U3H4
Domain Number 1 Region: 29-139
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 3.14e-36
Family N-utilization substance G protein NusG, N-terminal domain 0.00011
Further Details:      
 
Domain Number 2 Region: 147-201
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 2.41e-17
Family N-utilization substance G protein NusG, C-terminal domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0G0U3H4
Sequence length 201
Comment (tr|A0A0G0U3H4|A0A0G0U3H4_9BACT) Transcription termination/antitermination protein NusG {ECO:0000256|HAMAP-Rule:MF_00948, ECO:0000256|RuleBase:RU000538, ECO:0000256|SAAS:SAAS00126873} KW=Complete proteome; Reference proteome OX=1618424 OS=Candidatus Daviesbacteria bacterium GW2011_GWA2_40_9. GN=UU29_C0003G0030 OC=Bacteria; Candidatus Daviesbacteria.
Sequence
MSNDDQNITKTNDDQPQTPTPMVETGPRPRWYVVHTYSGHENKVATALKQRVESEHLEKK
ILDVLVPTQDKIEIRGGKKETVKEKIFPGYILVRILLDDTSWLAVKTTQGVTSFIGTSGK
PTPIADSEVESIVNFMQQGGQPTYKQVFIEGDTVKIIDGPFTEFIGKVETVDKEKGKVRI
LVSIFGRETPVELDFLQIAKL
Download sequence
Identical sequences A0A0G0U3H4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]