SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G0W1G4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G0W1G4
Domain Number 1 Region: 10-118
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 6.8e-40
Family N-utilization substance G protein NusG, N-terminal domain 0.0000565
Further Details:      
 
Domain Number 2 Region: 125-181
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 1.16e-18
Family N-utilization substance G protein NusG, C-terminal domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0G0W1G4
Sequence length 183
Comment (tr|A0A0G0W1G4|A0A0G0W1G4_9BACT) Transcription termination/antitermination protein NusG {ECO:0000256|HAMAP-Rule:MF_00948, ECO:0000256|RuleBase:RU000538, ECO:0000256|SAAS:SAAS00126873} KW=Complete proteome; Reference proteome OX=1618867 OS=Parcubacteria group bacterium GW2011_GWB1_41_4. GN=UU61_C0028G0009 OC=Bacteria; unclassified Parcubacteria group.
Sequence
MAKQQIEQDRNWYVIHTYSGYEDAVAKNLKQRIESLGMEDKIFNVIVPKEKKIKIKNGKR
KTVEEKIYPGYVLVEMNVTDESWYVVRNTPRVTGFLGAGTTPIPVSKSDMDDLMKRMEMG
EPEFTIDFEIGSTVKITDGPFKGFEGKVSELDKERGKIKVLVNMFGRDTPVELDSLQIKK
IGE
Download sequence
Identical sequences A0A0G0W1G4 A0A1G2JB83

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]