SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G0X146 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G0X146
Domain Number 1 Region: 1-128,158-210
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.83e-30
Family Nucleotide and nucleoside kinases 0.00022
Further Details:      
 
Domain Number 2 Region: 124-160
Classification Level Classification E-value
Superfamily Microbial and mitochondrial ADK, insert "zinc finger" domain 0.00000000000748
Family Microbial and mitochondrial ADK, insert "zinc finger" domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0G0X146
Sequence length 218
Comment (tr|A0A0G0X146|A0A0G0X146_9BACT) Adenylate monophosphate kinase {ECO:0000256|HAMAP-Rule:MF_00235} KW=Complete proteome OX=1618556 OS=Candidatus Woesebacteria bacterium GW2011_GWA1_41_7. GN=UU74_C0011G0006 OC=Bacteria; Candidatus Woesebacteria.
Sequence
MNIVLLGSPASGKGTQAEILCQKFDLFHLSTGDVARNLAETDPRIKEIVTSGKLIPPEEM
TMHVLDFLEKQKTDLKDILFEGFPRFVSQYEALDNFLKSKGDDLDIVISLEVPMEVAVKR
ISSRWMCSKCGEIYNTETKPSEKSGICDKCGSPLIQREDDKPDSVKTRFDYYVKNTKELI
DYVDGKGKLTRVNGDRSIDEIAKDLENIVREASKNDHN
Download sequence
Identical sequences A0A0G0QXQ3 A0A0G0S1W5 A0A0G0VIF9 A0A0G0X146 A0A0G0XS71 A0A0G0Y8G9 A0A1F8CZN4 A0A1F8DG32

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]