SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G0XPW8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G0XPW8
Domain Number 1 Region: 2-158
Classification Level Classification E-value
Superfamily Homing endonucleases 3.12e-30
Family Group I mobile intron endonuclease 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0G0XPW8
Sequence length 163
Comment (tr|A0A0G0XPW8|A0A0G0XPW8_9BACT) Uncharacterized protein {ECO:0000313|EMBL:KKS26865.1} KW=Complete proteome; Reference proteome OX=1619029 OS=Candidatus Yanofskybacteria bacterium GW2011_GWC2_41_9. GN=UU84_C0014G0005 OC=Bacteria; Candidatus Yanofskybacteria.
Sequence
MNNNSKLCGDYVAGFVDGEGCFYLTYRSEMRHERAGSPTYFRWTPYFAINIRADDREILE
KIKNLLNCGHIYLLKEGSMAHYIIQNMDDLFKKILPFFNKYPLRAKKRYDFELWSQALKI
MYKHKKDKTRCTPAENQKLFAIRENMRAYKSKMTRGYKNSPNH
Download sequence
Identical sequences A0A0G0XGX0 A0A0G0XPW8 A0A1F8EGW4 A0A1F8HVP7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]