SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G1BI81 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G1BI81
Domain Number 1 Region: 147-210
Classification Level Classification E-value
Superfamily PsbU/PolX domain-like 4.58e-18
Family PsbU-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0G1BI81
Sequence length 210
Comment (tr|A0A0G1BI81|A0A0G1BI81_9BACT) ComEA protein {ECO:0000313|EMBL:KKS37128.1} KW=Complete proteome; Reference proteome OX=1619138 OS=candidate division WWE3 bacterium GW2011_GWF1_42_14. GN=UV00_C0017G0021 OC=Bacteria; candidate division WWE3.
Sequence
MLPNRAAIILSVALAFVAGYFISQLYPVFYSDKSSVAPIETTCDGTVDISVEISGAVSNP
GVYNLKEGSRIIDALKIAGDFTSDYDYYWVSKNINLSQILKDEQKIFIPFEALGYSVNPG
SGYQEIFPSLQPSFVTESSGSSAAATGSQGAGTVNVNTATFDELDALPGIGATYAGKIVA
NRPYSGVEEFKEKSGLTNSVYEKIKDLITY
Download sequence
Identical sequences A0A0G1BI81 A0A0G1D755

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]