SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G1D6P4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G1D6P4
Domain Number 1 Region: 2-77
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 9.42e-27
Family Ribosomal L27 protein 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0G1D6P4
Sequence length 93
Comment (tr|A0A0G1D6P4|A0A0G1D6P4_9BACT) 50S ribosomal protein L27 {ECO:0000313|EMBL:KKS93377.1} KW=Complete proteome; Reference proteome OX=1618826 OS=Parcubacteria group bacterium GW2011_GWA2_43_13. GN=UV70_C0011G0067 OC=Bacteria; unclassified Parcubacteria group.
Sequence
MAHTKAGGSTQLGRDSQSKRLGVKKYGGEYVKPGMIIIRQRGTKVHAGVGVKQGKDDTLY
AGTEGKVAFSTRKLLKYHGKRVATKIVNVIPIQ
Download sequence
Identical sequences A0A0G1D6P4 A0A1G2A3Y5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]