SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G1DI01 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G1DI01
Domain Number 1 Region: 35-200
Classification Level Classification E-value
Superfamily MgtE membrane domain-like 6.54e-29
Family MgtE membrane domain-like 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0G1DI01
Sequence length 202
Comment (tr|A0A0G1DI01|A0A0G1DI01_9BACT) CBS domain containing protein {ECO:0000313|EMBL:KKS97324.1} KW=Complete proteome; Reference proteome OX=1618578 OS=Candidatus Woesebacteria bacterium GW2011_GWB1_43_14. GN=UV74_C0013G0446 OC=Bacteria; Candidatus Woesebacteria.
Sequence
MGSQKGILKLVMSTKITSLHRQASDLNVADAHFANEIRRRVPWMLFSVLAGIVMIWIGQA
YEGVLSQKVQLIFFIPMIVYMSDSIGTETLALFVRELALKRLSLKHVFLKEVLVGFSLGL
ASGIPLGLFGYVWLRDVTLSITIAITLIINGVIAVLIGMLLPIIFVKLGKDPALGTDEIT
TAISDNLSMVVYLLVATFMLFG
Download sequence
Identical sequences A0A0G1DI01

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]