SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G1I4F5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G1I4F5
Domain Number 1 Region: 3-115
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 0.000000193
Family AadK N-terminal domain-like 0.032
Further Details:      
 
Domain Number 2 Region: 130-216
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 0.00004
Family AadK C-terminal domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0G1I4F5
Sequence length 257
Comment (tr|A0A0G1I4F5|A0A0G1I4F5_9BACT) Polymerase beta domain protein region protein {ECO:0000313|EMBL:KKT54316.1} KW=Complete proteome; Reference proteome OX=1618523 OS=Microgenomates group bacterium GW2011_GWC1_44_23. GN=UW48_C0013G0003 OC=Bacteria.
Sequence
MDLLSADYRVLGIYLTGSFANGSPDQYSDLDVNLIVSVGDRESIIKEQETLREKVAKIAT
QFPATHLNNPYQIIVFYEGTYPIHVDYEYKTSEDLKPMAKGKDVIVVFDRTGELNSWKKA
CLGAAEEVTPTLDQLQYFEDRFWGWIIYTHGKIKRGELWEARDAIEYIRSNVLNRLAYYQ
LRLKDEGNRRLESKFTPEILNMLEKTIPKGHDKESYRLVLSNIVATYTKLFDRAVLANAV
EGINQADRDYLTKAVEF
Download sequence
Identical sequences A0A0G1I4F5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]