SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G1MV83 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G1MV83
Domain Number 1 Region: 71-224
Classification Level Classification E-value
Superfamily Sortase 3.66e-22
Family Sortase 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0G1MV83
Sequence length 225
Comment (tr|A0A0G1MV83|A0A0G1MV83_9BACT) Sortase family protein {ECO:0000313|EMBL:KKU12216.1} KW=Complete proteome; Reference proteome OX=1618559 OS=Candidatus Woesebacteria bacterium GW2011_GWA1_45_8. GN=UX19_C0004G0005 OC=Bacteria; Candidatus Woesebacteria.
Sequence
MKKRKRFWAFLVIRTIANALVITGIVFSFLAFAPFVKQEIWYWWKSNFQAISKPVDSQDT
NQPKVKAVELPPLSVEPESKEFGIVIEKIGVNAPVVANVNASSYPEYIGAMTKGVAHAKG
TAFPGSTKAENNNVFLFAHSAMNRVGAPKYNSVFYLLRKMEAGDRVSTFYQGKRYDYIVS
DKRVVEAKDVQYLTDPSKEPILTLQTCDPPGMNIRRLIVTAKLVQ
Download sequence
Identical sequences A0A0G1MV83

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]