SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G1PP29 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G1PP29
Domain Number 1 Region: 21-136
Classification Level Classification E-value
Superfamily S-adenosylmethionine decarboxylase 0.0000000628
Family Bacterial S-adenosylmethionine decarboxylase 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0G1PP29
Sequence length 137
Comment (tr|A0A0G1PP29|A0A0G1PP29_9BACT) Uncharacterized protein {ECO:0000313|EMBL:KKT98064.1} KW=Complete proteome; Reference proteome OX=1618506 OS=Microgenomates group bacterium GW2011_GWB1_45_17. GN=UX00_C0005G0009 OC=Bacteria.
Sequence
MHSISYTEPMLNSSKLSDKESFGQELILNLYECDLATISSGEKIKEFVITLCDDVIKMKR
YGEPLIPHFGHDNPITSGYSLVQLIETSSVTAHFSEYKKSIYLNIFSCAWFDAKKTERFC
KTFFGAKKVEAHLLHRE
Download sequence
Identical sequences A0A0G1PP29

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]