SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G1QNW9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G1QNW9
Domain Number 1 Region: 5-137
Classification Level Classification E-value
Superfamily Ribosomal protein L13 1.31e-50
Family Ribosomal protein L13 0.000014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0G1QNW9
Sequence length 142
Comment (tr|A0A0G1QNW9|A0A0G1QNW9_9BACT) 50S ribosomal protein L13 {ECO:0000256|HAMAP-Rule:MF_01366, ECO:0000256|SAAS:SAAS00766472} KW=Complete proteome; Reference proteome OX=1618532 OS=Microgenomates group bacterium GW2011_GWC2_46_7. GN=UX64_C0004G0013 OC=Bacteria.
Sequence
MKKTTSMVKTADIKRDWHLIDCKGETLGRLSTRLAGLLIGKHKSSYTPHMDMGDFVVVIN
AKDIKLTGNKLLDKYYYRHSGHPGGFTKESAGNLLIRDPRKIIEHAVEGMLPKNKLQDPR
LRRLKVYQSATHPHVAQFTKKD
Download sequence
Identical sequences A0A0G1QMS4 A0A0G1QNW9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]