SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G1RKH1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G1RKH1
Domain Number 1 Region: 149-280
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 0.00000000118
Family AadK C-terminal domain-like 0.0074
Further Details:      
 
Domain Number 2 Region: 7-72
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 0.0000286
Family Kanamycin nucleotidyltransferase (KNTase), N-terminal domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0G1RKH1
Sequence length 282
Comment (tr|A0A0G1RKH1|A0A0G1RKH1_9BACT) Uncharacterized protein {ECO:0000313|EMBL:KKU57809.1} KW=Complete proteome OX=1618358 OS=Candidatus Amesbacteria bacterium GW2011_GWA2_47_11b. GN=UX80_C0009G0024 OC=Bacteria; Candidatus Amesbacteria.
Sequence
MGSNISERLERIRKLIKSLQDKTYSQGEVLAFIVYGSFSEASDHKPTEYSDVDLEIVVKD
ENCKDYLNNFRSWFESNFEPVLIETSVGYLEKIFVTNDFVDLQFHITPLSDFDRIENRAI
NYFPNGYTLSFDKTSLLDNKIKASIKPKQQKTSQQKFDEINNAFWYFVLGIPPYFERKEY
WFAAAGYWAWLYVALCKLLRVYYKKEVEYNPMKHIEQALDNDVIERIQPLRNLETVDEMK
HKMNMLIDIFSEYTHKLIKQEALDYNPEIEEKVKNRIKSILS
Download sequence
Identical sequences A0A0G1P6Z5 A0A0G1RKH1 A0A0G1SFQ1 A0A0G1W0J1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]