SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G1SFW1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G1SFW1
Domain Number 1 Region: 2-97
Classification Level Classification E-value
Superfamily Phosphohistidine domain 7.46e-17
Family Pyruvate phosphate dikinase, central domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0G1SFW1
Sequence length 98
Comment (tr|A0A0G1SFW1|A0A0G1SFW1_9BACT) Uncharacterized protein {ECO:0000313|EMBL:KKU68296.1} KW=Complete proteome; Reference proteome OX=1618842 OS=Parcubacteria group bacterium GW2011_GWA2_47_16. GN=UX89_C0005G0010 OC=Bacteria; unclassified Parcubacteria group.
Sequence
MSGGIFVGKVKIVRNEADCKALDKTHVAIVAVPDRKHIHLLKRASAIVTETGGLLGHIAK
VAREDNLTFVGGIQDAASLFKDKDLVCVDGSKGTVTYA
Download sequence
Identical sequences A0A0G1SFW1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]