SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G1T9J7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G1T9J7
Domain Number 1 Region: 27-104
Classification Level Classification E-value
Superfamily Lamin A/C globular tail domain 0.00000837
Family Lamin A/C globular tail domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0G1T9J7
Sequence length 268
Comment (tr|A0A0G1T9J7|A0A0G1T9J7_9BACT) Putative cell surface glycoprotein {ECO:0000313|EMBL:KKU42075.1} KW=Complete proteome OX=1618495 OS=Microgenomates group bacterium GW2011_GWA1_46_7. GN=UX59_C0046G0009 OC=Bacteria.
Sequence
MFPTKLLIICTLSLIILLLVPAPVRAAVLLNEISPATNPEWIELYNDGDTLIDLTGFLLE
DGNTNHTDDLVLSGSLASHSYGVFFHNEGWLNNGGDTLKLYDNATPSANIIDQYTYGSLT
AEKSVFRSPNGSENWVTGFPTQNASNPAPSPSPSPSPTPSPTPTPTPTPTPIPSPTPPPS
PKPSLKPSPLSSPSLKLEETGTIAGQTIDINLSAFGASASPSPSISSKPTLNRSRAKTAL
ISGAGLVLISLAGFFGYRRTHQSTHPDV
Download sequence
Identical sequences A0A0G1T9J7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]