SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G1TBR9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G1TBR9
Domain Number 1 Region: 105-298
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 5.06e-39
Family Ribonuclease PH domain 1-like 0.0000152
Further Details:      
 
Domain Number 2 Region: 260-359
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.24e-24
Family Ribonuclease PH domain 2-like 0.00014
Further Details:      
 
Domain Number 3 Region: 366-449
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.93e-21
Family Eukaryotic type KH-domain (KH-domain type I) 0.0024
Further Details:      
 
Domain Number 4 Region: 422-506
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.26e-18
Family Cold shock DNA-binding domain-like 0.00038
Further Details:      
 
Domain Number 5 Region: 40-135
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0000000379
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0G1TBR9
Sequence length 540
Comment (tr|A0A0G1TBR9|A0A0G1TBR9_9BACT) Polyribonucleotide nucleotidyltransferase {ECO:0000256|SAAS:SAAS00979033} KW=Complete proteome; Reference proteome OX=1618846 OS=Parcubacteria group bacterium GW2011_GWA2_47_7. GN=UY04_C0015G0025 OC=Bacteria; unclassified Parcubacteria group.
Sequence
MIEMGGKEIAEDVIMEGLAYASKEIEKLQTFQKEIVAKRGKAKRVIVLEDVGEDIKALFK
EKISAKFESTIWGAAGRASEYALMEEWLGYVKEVEGMSDKLAEAYFDDMVNDLLHDKAIN
DSKRPDGRGFDDVRPLFAQAGGVSPVLHGTGIFYRGGTHVLSALTLGGPQDSQILEGMEV
QGKKRYMHHYNFPPFSSGETGRMGGMNRRAIGHGALAEKALIPVLPEKDIFPYTIRIVSE
SMASNGSTSMASVCGSTLALMDAGVPITEPVAGIASGLMMETESKYKVLTDIQGPEDHHG
DMDFKVAGTKNGVTAIQMDVKVGGIPLPILKEAFAKAKAARLTILETMKLAIAAPRTDIS
AYAPKIVVIKIKPDQIGMVIGSGGKTVNEIREQTGAEIDIEDDGTVFCTGKNGSAEKARD
IIAEMTHEYVAGEIFKGVVTRLMDFGAFVKIGFSAEGLVHVSEMASFRIDRVSDYMKEGM
EVPVVVKEVDDKGRINLSIKRADVNFIKPNEHDAKVINEHRDGDNGTAPKRFVPTPKPGV
Download sequence
Identical sequences A0A0G1TBR9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]