SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G1VSP1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G1VSP1
Domain Number 1 Region: 22-99
Classification Level Classification E-value
Superfamily EreA/ChaN-like 0.0000191
Family EreA-like 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0G1VSP1
Sequence length 106
Comment (tr|A0A0G1VSP1|A0A0G1VSP1_9BACT) Uncharacterized protein {ECO:0000313|EMBL:KKU81158.1} KW=Complete proteome; Reference proteome OX=1618438 OS=Candidatus Gottesmanbacteria bacterium GW2011_GWA1_47_8. GN=UY08_C0001G0003 OC=Bacteria; Candidatus Gottesmanbacteria.
Sequence
MENAKLPTSLPREFYRYFWDVNAEKLNPAEHPKYVINRLMNIGNVPSIRWMRQSFSQELI
VETVKTVRDFSSTTAMFWAHFYHIPREEVTCMQEPYLSMRRKFWHD
Download sequence
Identical sequences A0A0G1VSP1 A0A1F5ZL12

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]