SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G1WVJ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G1WVJ8
Domain Number 1 Region: 37-130
Classification Level Classification E-value
Superfamily Homing endonucleases 2.76e-19
Family Group I mobile intron endonuclease 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0G1WVJ8
Sequence length 179
Comment (tr|A0A0G1WVJ8|A0A0G1WVJ8_9BACT) Uncharacterized protein {ECO:0000313|EMBL:KKW22903.1} KW=Complete proteome OX=1618671 OS=Candidatus Kaiserbacteria bacterium GW2011_GWA2_52_12. GN=UY67_C0033G0001 OC=Bacteria; Candidatus Kaiserbacteria.
Sequence
MKADSYTTPPVSEVPGDTLGSMRANAVGKRCSVAERAYLAGLIDGDGAIMALIEPMHEKR
FRFRVRIELKITQKNERDLMFLNELLGCGSVRKNRTTCDWLTRDQQHILRILSLVRPYSR
MKQRQIAFASKIIDTPIRERRDLLRVARLADALSKFNVRSKLRRKNYATMIQEHFSPND
Download sequence
Identical sequences A0A0G1WVJ8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]