SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G1X7V3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G1X7V3
Domain Number 1 Region: 164-211
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000000811
Family Type I dockerin domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0G1X7V3
Sequence length 216
Comment (tr|A0A0G1X7V3|A0A0G1X7V3_9BACT) PKD domain-containing protein {ECO:0000313|EMBL:KKU98668.1} KW=Complete proteome OX=1618666 OS=Candidatus Jorgensenbacteria bacterium GW2011_GWC1_48_8. GN=UY32_C0017G0002 OC=Bacteria; Candidatus Jorgensenbacteria.
Sequence
MKKYLVLLATSGIIFPVFVMAEPFPDFPMAFWGTVTINLQPAPAGTLIRAYVSDVVMGQV
VTQESGVYGYTGPTKQKLIVGSSSGTIVFSFQNPSLYGGMETKGTVSQTHSPFVSGETIN
KNLAFAFTEATTLSGGSGGGGGGGGGGSSPSQTSLSTLGALSSKGDANNDGKINVLDFNS
LMVNWGKISVEATSDFNNDGRVDIFDFNILMINWSK
Download sequence
Identical sequences A0A0G1X7V3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]