SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G1X9W8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G1X9W8
Domain Number 1 Region: 2-121
Classification Level Classification E-value
Superfamily Homing endonucleases 6.24e-16
Family Group I mobile intron endonuclease 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0G1X9W8
Sequence length 151
Comment (tr|A0A0G1X9W8|A0A0G1X9W8_9BACT) Uncharacterized protein {ECO:0000313|EMBL:KKU99393.1} KW=Complete proteome OX=1618666 OS=Candidatus Jorgensenbacteria bacterium GW2011_GWC1_48_8. GN=UY32_C0001G0028 OC=Bacteria; Candidatus Jorgensenbacteria.
Sequence
MPELSYDYIRGLVEGEGTFTFSTRPKKMPDGSMGKEKIPSFAINMHERDEALLIAVRDTL
GLTNKVHKHGSANRKNPNHAKQAMLIVRENGQIKNIIIPFFYKKLYGNKGKQFAEWLEKM
GNSDTSEYSQALHKLYKSGWFDENRRNFGFG
Download sequence
Identical sequences A0A0G1W934 A0A0G1X9W8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]