SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G2ABU7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G2ABU7
Domain Number 1 Region: 51-106
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000000314
Family Type I dockerin domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0G2ABU7
Sequence length 109
Comment (tr|A0A0G2ABU7|A0A0G2ABU7_9BACT) Uncharacterized protein {ECO:0000313|EMBL:KKW38532.1} KW=Complete proteome OX=1619060 OS=Candidatus Peribacteria bacterium GW2011_GWB1_54_5. GN=UY85_C0029G0016 OC=Bacteria; Candidatus Peregrinibacteria; Candidatus Peribacteria.
Sequence
MHTHNRSIFSRQNLHILSLGTLAIVASFSLGIQSAGEVQPISLIEAGSIQLSGDVDGSGE
VTVRDAIVILEIARGYVQATPEQLRADPNGDGTLTVDDAIRILRELSPR
Download sequence
Identical sequences A0A0G2ABU7 A0A1F7D0R2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]