SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G2B7F2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G2B7F2
Domain Number 1 Region: 112-226
Classification Level Classification E-value
Superfamily L,D-transpeptidase catalytic domain-like 8.89e-32
Family L,D-transpeptidase catalytic domain-like 0.00082
Further Details:      
 
Domain Number 2 Region: 22-101
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.00000106
Family TSP type-3 repeat 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0G2B7F2
Sequence length 238
Comment (tr|A0A0G2B7F2|A0A0G2B7F2_9BACT) Peptidoglycan transpeptidase, ErfK-YbiS-YhnG family {ECO:0000313|EMBL:KKW41374.1} KW=Complete proteome; Reference proteome OX=1619044 OS=Candidatus Magasanikbacteria bacterium GW2011_GWA2_56_11. GN=UY92_C0021G0008 OC=Bacteria; Candidatus Magasanikbacteria.
Sequence
MKYFLIMFGVLALVPQLALGETLDTDADGLSDELERAYYTDPVNPDTDGDGFPDGQEVDS
GYSPDGLNDLLEIAFGTDIGFSDSDQDGFSDFTEVMHGYNPLSDQLLARLPRRVEVDLAK
QRLYYVVDGKLVNNFPVSTGNPWTPTPPGSYTISRLIPVARYVGRDYDLPNVKWNMQFRN
GGYFIHGAYWHNDFGKRTHSHGCVNMRTADAEYLYRYMEPGVEVVVAGQTPKRREVGT
Download sequence
Identical sequences A0A0G2B7F2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]