SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G2DVG4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G2DVG4
Domain Number 1 Region: 74-193,275-297
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.000000373
Family Regulator of G-protein signaling, RGS 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0G2DVG4
Sequence length 302
Comment (tr|A0A0G2DVG4|A0A0G2DVG4_9EURO) Putative integral membrane protein {ECO:0000313|EMBL:KKY14907.1} KW=Complete proteome; Reference proteome OX=158046 OS=Phaeomoniella chlamydospora. GN=UCRPC4_g06596 OC=Phaeomoniellales incertae sedis; Phaeomoniella.
Sequence
MPACTHNPRRFVPGMFVMETCLIFIPCWHVVRTRKLRNETLHILAEWEKVNTSTLYSSAS
ESTYAVSTTTFGGKRPTKPETYNMQALEKTLAENPTPLLVFAARKEFTGENVSYLMHIRR
WKEMWAGFESTSAKEADQNDHNEEYLRIRRRQFNLAVEIYIAFVSLKYSAFPINVPFDIF
KELEKLFQSPASLLCTQSDENTVVPFERNSSNVELHQISDKSDTALVLTPSIASGMSGQT
TAQFDLVNDQSLRLFNIANRLPDDIQIPEAFDPMVFDKSVKNIQYLVYTNTWPKFVSASS
EA
Download sequence
Identical sequences A0A0G2DVG4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]