SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G2EM62 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G2EM62
Domain Number 1 Region: 327-472
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 6.93e-27
Family Regulator of G-protein signaling, RGS 0.00099
Further Details:      
 
Domain Number 2 Region: 193-299
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.4e-19
Family DEP domain 0.019
Further Details:      
 
Domain Number 3 Region: 17-141
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000144
Family Rps19E-like 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0G2EM62
Sequence length 485
Comment (tr|A0A0G2EM62|A0A0G2EM62_9PEZI) Putative developmental regulator {ECO:0000313|EMBL:KKY23394.1} KW=Complete proteome; Reference proteome OX=420778 OS=Diplodia seriata. GN=UCDDS831_g03125 OC=Botryosphaeriaceae; Diplodia.
Sequence
MHQTSSRLLRMTDDDRPFTRDFKDLFSTLMVSLPLSPHRVRWQKVDHSFTSEEAMTNLGS
LKFSQSNRMPDPKDPSRIVTTTTTTTFSMAKEMARSVCQKFLEARFIESVEGKSDFMSKT
SVWQMTPKGMHVLQRFCQRNGINQKHVYEVLDSPRNTMHLVILERETETDKLNHDNATTE
VVFRRFVGHEGPNAKANTAQADSDSLNEYSTGLVGVKMARERKIGDKVYMNTFTGKAAVD
WLMDCSTMVDKREAFEMCALFYEFGLMASVEAFPNPGRFQPTKSAIYYVTEKGQRTAGWI
QSPKTSLNGDAAPNNRPREGTTRDSNANRMTVIIRDPALRLLFREFLRETHCEENLSFYL
DVSEFLNGYKAAKRANASPKLEVIRETLAAAYSLYNAFLAPGSPCELNIDHSLRTALAAR
MTRAVGDDEAMVRSLDEVATLFDQAQNSVFKLMASDSVPKFMREPKYASVIRDRNLDAAP
AMVAS
Download sequence
Identical sequences A0A0G2EM62

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]