SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G2F431 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G2F431
Domain Number 1 Region: 9-57
Classification Level Classification E-value
Superfamily DEK C-terminal domain 0.00000262
Family DEK C-terminal domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0G2F431
Sequence length 208
Comment (tr|A0A0G2F431|A0A0G2F431_9EURO) Putative swib mdm2 domain protein {ECO:0000313|EMBL:KKY29021.1} KW=Complete proteome; Reference proteome OX=158046 OS=Phaeomoniella chlamydospora. GN=UCRPC4_g00210 OC=Phaeomoniellales incertae sedis; Phaeomoniella.
Sequence
MAKFDEVRDQYVKVIDGILAASDLSTVSQKRIRKGIQEAVDFDITPHKASINDLILERFD
EFNARQNGAGAASQKNTETAASPTPPTTNGHATTSPSPSPVKRQSESEELSEVADDAPPK
KKRKPDNVDSDALIAARLQAEENARARPTRGGSTRKATPAKKRASKKKTEKKVRAEDDSD
LSGSEADKPVKNTGFHVSGPELESIESS
Download sequence
Identical sequences A0A0G2F431

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]