SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G2FJN7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G2FJN7
Domain Number 1 Region: 12-113
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 5.23e-28
Family Steroid-binding domain 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0G2FJN7
Sequence length 130
Comment (tr|A0A0G2FJN7|A0A0G2FJN7_9PEZI) Putative heme binding protein {ECO:0000313|EMBL:KKY34311.1} KW=Complete proteome; Reference proteome OX=1214573 OS=Diaporthe ampelina. GN=UCDDA912_g05716 OC=Diaporthe.
Sequence
MPDFKPKTLVQLAPPKDDPISLEELAKADGKDGAKCYVAIKGKVYDVTGNKMYQPGSSYN
VFAGKDASRALGKTSTNPDDVSPEWKDLSDKEKGTLNDWVKFFSNRYNVVGTVEGATNFD
DEPAVEASSS
Download sequence
Identical sequences A0A0G2FJN7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]