SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G2H825 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G2H825
Domain Number 1 Region: 5-141
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 6.51e-27
Family Phosphate binding protein-like 0.00079
Further Details:      
 
Domain Number 2 Region: 143-214
Classification Level Classification E-value
Superfamily Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain 0.0000000000017
Family Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0G2H825
Sequence length 221
Comment (tr|A0A0G2H825|A0A0G2H825_9PEZI) Putative porphobilinogen deaminase {ECO:0000313|EMBL:KKY31373.1} KW=Complete proteome; Reference proteome OX=1214573 OS=Diaporthe ampelina. GN=UCDDA912_g08718 OC=Diaporthe.
Sequence
MSTIVKALRTLGDKDQSTALYNFGAKSLWTTELEEKLTSGQLDVIVHCLKDPTARRGGRH
LRFANLRGNVKRRLAKVDKPESEYTCMIMSAAGLERVGLKRRITQHLGSKDGGILHAVGQ
GALGLEIRKGDAAVLELLNQLVDRKSALACLAERALMRTLEGGCSVPIGVETEWLDPQRD
SVLRMRAIVRSGKKSMMAASLVEAGADANLKNINTHRPSKD
Download sequence
Identical sequences A0A0G2H825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]