SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G2I8H7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G2I8H7
Domain Number 1 Region: 137-232
Classification Level Classification E-value
Superfamily Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 1.13e-16
Family Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.00046
Further Details:      
 
Domain Number 2 Region: 393-408,462-573
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000366
Family Pseudo ankyrin repeat 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0G2I8H7
Sequence length 657
Comment (tr|A0A0G2I8H7|A0A0G2I8H7_9EURO) Uncharacterized protein {ECO:0000313|EMBL:KKZ66902.1} KW=Complete proteome; Reference proteome OX=1247875 OS=Emmonsia crescens UAMH 3008. GN=EMCG_07398 OC=Eurotiomycetidae; Onygenales; Ajellomycetaceae; Emmonsia.
Sequence
MAVDFTPPHALSPQDSKLEALRDKVTGMPGVALDNSGAGTETGGDAHVYGNKNGAVVVEL
DKNNWLSSAKLSCNNKLRKRVLISTNASFAEVAIPFLQKISDVELRVISDDVLDIMQGSC
YPDTPISAQPGSKLSSRPWMNATAAELISWADVLILSPIDAGTLGAMIAGLTTSLTLMVL
RGWDITKTVLLVPRMTTSEWQSPMTKRQLSELATFWSWVKVLPPALSKFEPPAGLVEIPW
DGWATFSSKVRKCLGCPFPPSTIQEDDKLAKDVASGNGSTPLAIPSSLHEREQSVNNEAY
QNGTNQDPTSAIRKEKPILPPELLTMILEMLDDWETAASVGVYAKIPVPEKWKPYIPTPR
APATFEYTVLRGSMKEIEQQLSTIPPRKPLSKIVTDLILKFSRTDILDSLCKLRMDLYLS
TPQLKNLPLSASSKFGSTSLLTWWRNCSTLPTLPIKDYLPEAIDAASRAGFVHVLEWWRQ
SGLPFRYTEKSLESASAEGRIAVLDWWKNVSKNALLGDPVPLKVGKSVLLAAQSGRTDSL
AWWDKSDIPFSHAESVTRIASNHGHVPVLDFWHRRKREKLIFDNQVLVGATKNGHVEVLE
WWKRSGLPVEFKTCDIEEALEDAVSGVEQRVRRWWARNGLNLGVGTNEWMMVKTLNT
Download sequence
Identical sequences A0A0G2I8H7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]