SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G2JIV5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G2JIV5
Domain Number 1 Region: 5-62
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000707
Family RING finger domain, C3HC4 0.012
Further Details:      
 
Domain Number 2 Region: 68-126
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000321
Family B-box zinc-binding domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0G2JIV5
Sequence length 258
Comment (tr|A0A0G2JIV5|A0A0G2JIV5_HUMAN) Tripartite motif-containing protein 40 {ECO:0000313|Ensembl:ENSP00000402617} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=TRIM40 OC=Catarrhini; Hominidae; Homo.
Sequence
MIPLQKDNQEEGVCPICQESLKEAVSTNCGHLFCRVCLTQHVEKASASGVFCCPLCRKPC
SEEVLGTGYICPNHQKRVCRFCEESRLLLCVECLVSPEHMSHHELTIENALSHCKERLNR
RSRKLRKDIAELQRLKAQQEKKLQALQFQVDHGNHRLEAGPESQHQTREQLGALPQQWLG
QLEHMPAEAARILDISRAVTQLRSLVIDLERTAKELDTNTLKNAGDLLNRSAPQKLEVIY
PQLEKGVSELLLQPPQKL
Download sequence
Identical sequences A0A0G2JIV5
ENSP00000399450 ENSP00000402617 ENSP00000448384 ENSP00000402617 ENSP00000448384 9606.ENSP00000411663

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]