SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G2JUG4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G2JUG4
Domain Number 1 Region: 255-382
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.83e-41
Family Regulator of G-protein signaling, RGS 0.0000265
Further Details:      
 
Domain Number 2 Region: 180-244
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 4.84e-19
Family Transducin (heterotrimeric G protein), gamma chain 0.0027
Further Details:      
 
Domain Number 3 Region: 1-62
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000256
Family DEP domain 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0G2JUG4
Sequence length 421
Comment (tr|A0A0G2JUG4|A0A0G2JUG4_RAT) Regulator of G-protein-signaling 6 {ECO:0000313|Ensembl:ENSRNOP00000069089} KW=Complete proteome; Reference proteome OX=10116 OS=Rattus norvegicus (Rat). GN=Rgs6 OC=Muroidea; Muridae; Murinae; Rattus.
Sequence
MKNLSIEDPVEAIHLGSLIAAQGYVFPISDHVLTMKDDGTFYRFQAPYFWPSNCWEPENT
DYAIYLCKRTMQNKARLELADYEAENLARLQRAFARKWEFIFMQAEAQVKIDRKKDKTER
KILDSQERAFWDVHRPVPGCVNTTEMDIRKCRRLKNPQKVKKSVYGVTDESQSQSPVHIP
SQPIRKTTKDDIRKQITFLNAQIDRHCLKMSKVAESLIAYTEQYVEYDPFITPAEPSNPW
ISDDITLWDIEMSKEPSQQRVKRWGFSFDEILKDQVGRDQFLRFLESEFSSENLRFWLAV
QDLKKQPLQDVAKRVEEIWQEFLAPGAPSAINLDSHSYEITSQNVKDGGRYTFEDAQEHI
YKLMKSDSYARFLRSNAYQDLLLAKKKPESEQGRRTSLEKFTRSVGKSLAGKRLTGLMQS
S
Download sequence
Identical sequences A0A0G2JUG4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]