SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G2JUH8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G2JUH8
Domain Number 1 Region: 557-677
Classification Level Classification E-value
Superfamily PX domain 2.49e-24
Family PX domain 0.0012
Further Details:      
 
Domain Number 2 Region: 372-518
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.65e-24
Family Regulator of G-protein signaling, RGS 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0G2JUH8
Sequence length 958
Comment (tr|A0A0G2JUH8|A0A0G2JUH8_RAT) Sorting nexin 13 {ECO:0000313|Ensembl:ENSRNOP00000069103} KW=Complete proteome; Reference proteome OX=10116 OS=Rattus norvegicus (Rat). GN=Snx13 OC=Muroidea; Muridae; Murinae; Rattus.
Sequence
MMLTEASLSIWGWGSLGIVLFLITFGPFVIFYLAFYILCFVGGGLVVTLLYGKTNSEKYL
EQCEHSFLPPTSPGVPKCLEEMKREARTIKIDRRLTGANIIDEPLQQVIQFSLRDYVQYW
YYTLSDDETFLLEIRQTLQNALIQFATRSKEIDWQPYFTTRMVDDFGTHLRVFRKAQQRV
TEKDDQVKGTAEDLVETFFEVEVEMEKDVCRDLVCTSPKDEEGFLRDLCEVLLYLLLPPG
DFQSKIMRYFVREILARGILLPLINQLSDPDYINQYVIWMIRDSNCNYEAFMNIIKLSDN
IGELEAVRDKAAEELQYLRSLDTAGDDINTIKNQINSLLFVKKVCDSRIQRLQSGKEINT
VKLAANFGKLCTVPLDSILVDNVALQFFMDYMQQTGGQAHLFFWMTVEGYRVTAQQQLEV
LSSRQRDGKQQTNQTKGLLRAAAVGIYEQYLSEKASPRVIVDDYLVAKLADTLNHEDPTP
EIFDDIQRKVYELMLRDERFYPSFRQNPLYVRMLAELDMLKDPSFRGSDDGDGESFNGSP
TGSINLSLDDLSSVTSDDSVQLHAYISDTGVCNDHGKTYALYAITVHRRSLNTEEMWKTY
RRYSDFHDFHMRITEQFENLSSILKLPGKKTFNNMDRDFLEKRKKDLNAYLQLLLTPEML
KASPALAHCVYDFLENKAYSKGKGDFARKMDTFVNPLRNSMRNVSNAVKSLPDSLAEGVT
KMSDNVGRMSERLGQDIKQSFFKVPPLITKTDSDPEHCRVSAQLDDNVDDNIPLRVMLLL
MDEVFDLKERNQWLRRNIKNLLQQLIRATYGDTINRKIVDHVDWMTSPEQVADSVKRFRD
ALWPNGILAEAAPCRDKAIRMRTRIAGKTKLFAVMPDELKHIIGAETTRKGILRVFEMFQ
HNQLNRRMVYVFLEGFLETLFPQYKFRELFNKLHSRSKQMQKYKQKLQSTQAPSLQKR
Download sequence
Identical sequences A0A0G2JUH8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]