SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G2JUN9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G2JUN9
Domain Number 1 Region: 108-396
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.88e-78
Family Protein kinases, catalytic subunit 0.0000145
Further Details:      
 
Domain Number 2 Region: 46-127
Classification Level Classification E-value
Superfamily SH3-domain 9.06e-21
Family SH3-domain 0.00055
Further Details:      
 
Weak hits

Sequence:  A0A0G2JUN9
Domain Number - Region: 415-483
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.00235
Family Regulator of G-protein signaling, RGS 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0G2JUN9
Sequence length 1077
Comment (tr|A0A0G2JUN9|A0A0G2JUN9_RAT) Mitogen-activated protein kinase kinase kinase {ECO:0000256|PIRNR:PIRNR000556} KW=Complete proteome; Reference proteome OX=10116 OS=Rattus norvegicus (Rat). GN=Map3k9 OC=Muroidea; Muridae; Murinae; Rattus.
Sequence
MESSRSLLGCLASAAAAPPGEDATGAGAEEEEDEEEAAAELGSHATLPYWTAVFEYEAAG
EDELTLRLGDVVEVLSKDSQVSGDEGWWTGQLNQRVGIFPSNYVTPRSAFSSRCQPGTED
PSCYPPIQLLEIDFAELTLEEIIGIGGFGKVYRAFWVGDEVAVKAARHDPDEDISQTIEN
VRQEAKLFAMLKHPNIIALRGVCLKEPNLCLVMEFARGGPLNRVLSGKRVPPDILVNWAV
QIARGMNYLHDEAIVPVIHRDLKSSNILILQKVENGDLSNKTLKITDFGLAREWHRTTKM
SAAGTYAWMAPEVIRASMFSKGSDVWSYGVLLWELLTGEVPFRGIDGLAVAYGVAMNKLA
LPIPSTCPEPFAKLMEDCWNPDPHSRPSFSSILDQLTTIEESGFFEMPKDSFHCLQDDWK
HEIQEMFDQLRAKEKELRTWEEELTRAALQQKNQEELLRRREQELAEREIDILERELNII
IHQLCQEKPRVKKRKGKFRKSRLKLKDGNRISLPSDFQHKFTVQASPTMDKRKSLISNRS
SPPASPTIIPRLRAIQLTPGESSKTWGRSSVVPKEEGEEEEKRAPKKKGRTWGPGTLGQK
ELTSGDEGLKSLVDGYKQWSSSAPNLGKGPRSSPALPGFTSLMEIEDEDSEGPGSGENHL
QHSPNQSYLCIPFPRGEDGDGPSSDGIHEEPTPVNSATSTPQLTPTNSLKRSGTHHRRCE
VALLGCGAVLAATGLGFDLLEAGKCQLLPPEEPEPPAREEKKRREGLFQRASRPRRSTSP
PSRKLFKKEEPMTLLGDPSASLTLLSLSSISECNSTRSLLRSDSDEIVVYEMPVSPVEAP
PLTQCTQNPLVNVRVERFKRDPNQSLTPTHVTLTAPTQPSGHRRTPSDGALKPASVPPAL
GSRSPSSNGVSPGPGAGMLKTPSPSRDPGEFPRLPDPNVVFPPTPRRWNTQRDSTLERPK
TLEFLPRPRPSANRQRLDPWWFVSPSHARSASPANSSSTETPSNLDSCFASSSSTVEERP
GLPALLPLQAGPLPPAERTLLDLDAEGQSQDSTVPLCRAELNAHGPSPYEIQQEFWS
Download sequence
Identical sequences A0A0G2JUN9
10116.ENSRNOP00000009693 NP_001094342.1.100692 NP_001094342.1.4139 ENSRNOP00000009693 ENSRNOP00000009693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]