SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G2JZT9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G2JZT9
Domain Number 1 Region: 1-63
Classification Level Classification E-value
Superfamily RNA polymerase subunit RPB10 7.06e-27
Family RNA polymerase subunit RPB10 0.0000868
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0G2JZT9
Sequence length 67
Comment (tr|A0A0G2JZT9|A0A0G2JZT9_RAT) Uncharacterized protein {ECO:0000313|Ensembl:ENSRNOP00000071181} KW=Complete proteome; Reference proteome OX=10116 OS=Rattus norvegicus (Rat). GN= OC=Muroidea; Muridae; Murinae; Rattus.
Sequence
MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGHALDALGLKCYCCRRVLLAHVDLIEKLL
NYAPLEK
Download sequence
Identical sequences A0A0G2JZT9
ENSRNOP00000034659 10116.ENSRNOP00000034659

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]