SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G2K1B5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G2K1B5
Domain Number 1 Region: 1008-1138
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.03e-45
Family Regulator of G-protein signaling, RGS 0.00000618
Further Details:      
 
Domain Number 2 Region: 33-157
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.19e-21
Family Synaptotagmin-like (S variant) 0.001
Further Details:      
 
Domain Number 3 Region: 187-270
Classification Level Classification E-value
Superfamily PDZ domain-like 7.32e-18
Family PDZ domain 0.00000985
Further Details:      
 
Domain Number 4 Region: 448-551
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000527
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0G2K1B5
Sequence length 1144
Comment (tr|A0A0G2K1B5|A0A0G2K1B5_RAT) Regulator of G-protein-signaling 3 {ECO:0000313|Ensembl:ENSRNOP00000071774} KW=Complete proteome; Reference proteome OX=10116 OS=Rattus norvegicus (Rat). GN=Rgs3 OC=Muroidea; Muridae; Murinae; Rattus.
Sequence
MEWPHQDTSLSRKDACTQTYPPRRRIRHAQLQDAGQLKLSIGAQDRVLLLHVIEGKGLIS
KKPGICDPYVKISLIPEDSQLCCQTTQVIRDCRDPAFHEHFFFPVPEEGDQKRLLVTVWN
QASETRQHALIGCMSFGVRSLLTPDKEISGWYYLLGEDLGRTKHLKVARRRLQPLRDVLL
RMPGDGDPENGEKLQITIRRGKDGFGFTICCDSPVRVQAVDSGGPAERAGLQQLDTVLQL
NERPVEHWKCVELAHEIRSCPSEIILLVWRVVPQIKPGPDGGVLRRASCKSTHDLLSPPN
KREKNCTHGAPTRPEQRHSCHLVCDSSDGLLLGGWERYTEVGKRSGQHTLPALSRATTPT
DPNYIILAPLNPGSQLLRPVYQEDAIPEEPGTTTKGKSYTGLGKKSRLMKTVQTMKGHSN
YQDCSALRPHIPHSSYGTYVTLAPKVLVFPVFVQPLDLCNPARTLLLSEELLLYEGRNKT
SQVTLFAYSDLLLFTKEEEPGRCDVLRNPLYLQSVKLQEGSSEDLKFCVLYLAEKAECLF
TLEAHSQEQKKRVCWCLSENIAKQQQLAATPTERKMFETEADEKEMPLVEGKGPGAEERT
PSKDPSPSQELPPGQELPPSKDPSPSQELPPGQDLPPSKDPSPSQELPPGQELPPSKDPS
PSQELPAGQDLPPRKESFSGQEAAPGPESPSSEDIATCQNPPQSPETSTSKDSPPGQGSS
PTTEVPSCQGLPAGQESTSQDPLLSQEPPAIPESSASDQNVLPSQESPPSQGSLSEKALA
EQTISPGELPAATAGEPSASRPNFVIPEVRLDSAYSQQDGAHGGSSGEDEDAEEGEEGEE
GEEDEEDDTSDDNYGDRNEAKRSSLIETGQGAEGGLSLRVQNSLRRRTHSEGSLLQEARG
PCFASDTTLHCSDGEGTTSTWAIPSPRTLKKELGRNGGSMHHLSLFFTGHRKMSGTDLAD
DVEASRKRKSKNIAKDMKNKLAIFRRRNESPGAQPAGKADKTTKSFKPTSEEALKWSESL
EKLLLHKYGLEVFQAFLRTEFSEENLEFWLACEDFKKVKSQSKMAAKAKKIFAEFIAIQA
CKEVNLDSYTREHTKENLQSITRGCFDLAQKRIFGLMEKDSYPRFLRSDLYLDLINQKKM
SPPL
Download sequence
Identical sequences A0A0G2K1B5
XP_017449084.1.100692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]