SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G2K405 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G2K405
Domain Number 1 Region: 273-413
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.67e-36
Family cAMP-binding domain 0.00000242
Further Details:      
 
Domain Number 2 Region: 118-269
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 5.76e-27
Family cAMP-binding domain 0.00000131
Further Details:      
 
Domain Number 3 Region: 2-44
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000000000353
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0G2K405
Sequence length 423
Comment (tr|A0A0G2K405|A0A0G2K405_RAT) cAMP-dependent protein kinase type II-alpha regulatory subunit {ECO:0000313|Ensembl:ENSRNOP00000072848} KW=Complete proteome; Reference proteome OX=10116 OS=Rattus norvegicus (Rat). GN=Prkar2a OC=Muroidea; Muridae; Murinae; Rattus.
Sequence
MSHIQIPPGLTELLQGYTVEVLRQQPPDLVDFAVEYFTRLREARRQESDSFIAPPTTFHA
QESSGVPVIEEDGESESDSDDEDLEVPIPSKFTRRVSVCAETFNPDEEEDNDPRVVHPKT
DEQRCRLQEACKDILLFKNLDQHLTRRFQGMSVHVLHQRGWHTVEQLSQVLDAMFEKIVK
TDEHVIDQGDDGDNFYVIERGTYDILVTKDNQTRSVGQYDNRGSFGELALMYNTPRAATI
VATSDGSLWGLDRVTFRRIIVKNNAKKRKMFESFIESVPLFKSLEMSERMKIVDVIGEKI
YKDGERIITQGEKADSFYIIESGEVSILIRSKTKTNKNGGNQEVEIAHCHKGQYFGELAL
VTNKPRAASAYAVGDVKCLVMDVQAFERLLGPCMDIMKRNISHYEEQLVKMFGSNLDLLD
PGQ
Download sequence
Identical sequences A0A0G2K405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]