SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G2K4L2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G2K4L2
Domain Number 1 Region: 40-229
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.47e-67
Family Regulator of G-protein signaling, RGS 0.0000000128
Further Details:      
 
Domain Number 2 Region: 392-619
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.19e-60
Family DBL homology domain (DH-domain) 0.000000493
Further Details:      
 
Domain Number 3 Region: 621-754
Classification Level Classification E-value
Superfamily PH domain-like 4.4e-35
Family Pleckstrin-homology domain (PH domain) 0.000035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0G2K4L2
Sequence length 914
Comment (tr|A0A0G2K4L2|A0A0G2K4L2_RAT) Rho guanine nucleotide exchange factor 1 {ECO:0000313|Ensembl:ENSRNOP00000073086} KW=Complete proteome; Reference proteome OX=10116 OS=Rattus norvegicus (Rat). GN=Arhgef1 OC=Muroidea; Muridae; Murinae; Rattus.
Sequence
MGEVAGGAAPGPPRSGLVHLWGGAEKTEAGQGGNPEDQNSQFQSLEQVKRRPAHLMALLQ
HVALQFEPGPLLCCLHADMLSSLGPKEAKKAFLDFYHSFLEKTAVLRVPVPPSVAFELDR
TRPDLISEDVQRRFIQEVVQSQQAAVTRQLEDFRSKRLMGMTPWEQELSLLEPWIGKDRG
NYEARERHVAERLLSHLEEMQHTISTDEEKSAAVVTAISLYMRHLGVRTKSGDKKSGRNF
FRKKVMGNRRSDEPPKTKKGLSSILDPARWNRGEPSAPDCRHLKVEVDEKPGPADRKGSL
GISSRDRTVGTPGQDNPGVSLHPLSVDSLDSREPGVDTPQEPGDTPPQGPTSLEPLAPPE
STEDNGETESPEPGDDGEPGRSGLEQEPEEPPGWRELVPSDTLLGLPKNQVKRQEVISEL
LVTEAAHVRMLRVLHDLFYQPMAEGGFFPLEELQNIFPSLDELIEVHSLFLDRLMKRRQE
SGYLIEEIGDVLLARFDGAEGSWFQKISSRFCSRQSFALEQLKAKQRKEPRFCAFVQEAE
SRPRCRRLQLKDMIPTEMQRLTKYPLLLQSIGQNTEEPAERAKVELAAECCREILHHVNQ
AVRDMEDLLRLKDYQRRLDLTHLRQSNDPMLSEFKNLDITKKKLVHEGPLTWRLTKDKAV
EVHVLLLDDLLLLLQRQDEGCCSSHSRTLTPTPDGKTMLRPVLRLTSAMTREVATDHKAF
YVIFTWDQEAQIYELVAQTSSERKSWCALITETAGSLKVPAPASRPKPRPSPSSTREPLL
SSSENGTGGTEAAPADARTERILNDLLPFCRPGPEGQLAATALQKVLSLKQILLSTEEDS
GAGPPRDGDGVPGGGAPGPTHTQEVEENLLSLEVVIKQLEELEEEFCRLRPFLSQLGEIL
SPNLAAPERSAQTG
Download sequence
Identical sequences A0A0G2K4L2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]